PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29661.m000901
Common NameRCOM_0578410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 440aa    MW: 49288.3 Da    PI: 5.7626
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29661.m000901genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.34.8e-92334372373
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl..fsevsPilk 92 
                    ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl+  f++AL ar a+  s+++k l++ ++++ +    ++++++ +l  f++++P+++
  29661.m000901  33 EQLLVHCANAIESNDATLAQQILWVLNNIAPPDGDSNQRLTCAFLRALIARAAK--SGTCKLLAAMANAHCTlaiDAHKFSVIELasFVDLTPWHR 126
                    79****************************************************..7777777666666555333344444444478********* PP

           GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl...v 182
                    f++ +aN  Ilea+eg + vHi+D+++++++Q p+L++a+a+R e +p++++T+ g  e        ++ee+g +L +fA++ +v +ef+v+   +
  29661.m000901 127 FGFTAANASILEAIEGFSVVHIVDLSLTHCMQIPTLIDAIANRFEVTPMIKLTVAGCTEDIppmLDLSYEELGCKLINFARSRNVIMEFRVVdssY 222
                    *****************************************************9999776688888999**********************98885 PP

           GRAS 183 akrledleleeLrvkp......gEalaVnlvlqlhrll.....................desvsleserdevLklvkslsPkvvvvveqeadhnse 251
                    a+ +++l +e+Lrv++      gEal++n+++  h+++                     ++s s++s r+ +Lk ++sl P++vv+v+++ad++s+
  29661.m000901 223 ADGFSSL-IEQLRVQNlvytdsGEALVINCHMLPHYIPeetlsgihnttnssnpysfesSSSSSMSSLRTMFLKSLRSLDPTIVVLVDEDADLTSN 317
                    5555555.66666666666669***********************************9999999999***************************** PP

           GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                    +++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r+er e +++W +r+++a F++++++e+a++++k++l +++  
  29661.m000901 318 NLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGLQRVERLEPKSRWVQRMRNANFRSISFGEEAVSEVKTMLGEHA-A 411
                    *************************************.********************************************************.8 PP

           GRAS 348 gyrveeesgslvlgWkdrpLvsvSaW 373
                    g+ +++e++ lvl+Wk++++v+++aW
  29661.m000901 412 GWGLKKEEDDLVLTWKGHNVVFATAW 437
                    999*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.8676419IPR005202Transcription factor GRAS
PfamPF035141.6E-8933437IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MNKNQIYQRT RPWPGFPTSK ALGNNFGDAN CMEQLLVHCA NAIESNDATL AQQILWVLNN  60
IAPPDGDSNQ RLTCAFLRAL IARAAKSGTC KLLAAMANAH CTLAIDAHKF SVIELASFVD  120
LTPWHRFGFT AANASILEAI EGFSVVHIVD LSLTHCMQIP TLIDAIANRF EVTPMIKLTV  180
AGCTEDIPPM LDLSYEELGC KLINFARSRN VIMEFRVVDS SYADGFSSLI EQLRVQNLVY  240
TDSGEALVIN CHMLPHYIPE ETLSGIHNTT NSSNPYSFES SSSSSMSSLR TMFLKSLRSL  300
DPTIVVLVDE DADLTSNNLV CRLRSAFNYL WIPYDTVDTF LPRGSKQRQW YEADICWKIE  360
NVIAHEGLQR VERLEPKSRW VQRMRNANFR SISFGEEAVS EVKTMLGEHA AGWGLKKEED  420
DLVLTWKGHN VVFATAWMPT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525254.20.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLB9SGY50.0B9SGY5_RICCO; Transcription factor, putative
STRINGPOPTR_0007s10030.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein